Reference-grade research compound
Tesamorelin
Synthetic 44-residue analog of human growth hormone-releasing hormone (1-44) with an N-terminal trans-3-hexenoyl modification
Sequence schematic — no PDB structure deposited
- Scientific name
- Synthetic 44-residue analog of human growth hormone-releasing hormone (1-44) with an N-terminal trans-3-hexenoyl modification
- Sequence
- YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
- Length
- 44-mer
- Molecular formula
- C221H366N72O67S
- Molecular weight
- 5135.86 g/mol
- Form
- lyophilized
- Available sizes
- 2 mg, 5 mg, 10 mg, 20 mg
- Storage
- Store lyophilized powder at −20 °C, desiccated and protected from light. Stable for 24 months.
- Batch HPLC purity
- 99.6%
Description
Synthetic 44-residue analog of human growth hormone-releasing hormone bearing an N-terminal trans-3-hexenoyl group that increases peptide stability. Used in vitro as a reference compound in GHRH receptor binding and cAMP accumulation assays in pituitary cell-line model systems. Supplied as a lyophilized acetate salt.
Storage and stability
Store lyophilized powder at −20 °C, desiccated and protected from light. Stable for 24 months.
Peer-reviewed references
Delineating tesamorelin response pathways in HIV-associated NAFLD using a targeted proteomic and transcriptomic approach.
Sci Rep · 2021
PMID 34006921PubMedEffects of tesamorelin on hepatic transcriptomic signatures in HIV-associated NAFLD.
JCI Insight · 2020
PMID 32701508PubMedAdvances in the detection of growth hormone releasing hormone synthetic analogs.
Drug Test Anal · 2021
PMID 34665524PubMed
Titles and journals pulled from PubMed and cached for 7 days. Links open in a new tab.