Reference-grade research compound
TB-500
Thymosin β-4 (full-length)
Loading 3D structure…
PDB 1T44
- Scientific name
- Thymosin β-4 (full-length)
- Sequence
- SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
- Length
- 43-mer
- Molecular formula
- C212H350N56O78S
- Molecular weight
- 4963.44 g/mol
- Form
- lyophilized
- Available sizes
- 2 mg, 5 mg, 10 mg
- Storage
- Store lyophilized powder at −20 °C, desiccated and protected from light. Stable for 24 months.
- Batch HPLC purity
- 99.2%
Description
43-residue actin-sequestering peptide. Used in vitro as a reference standard in G-actin/F-actin polymerization assays and in cell-migration model systems. Supplied as a lyophilized acetate salt.
Storage and stability
Store lyophilized powder at −20 °C, desiccated and protected from light. Stable for 24 months.
Peer-reviewed references
Thymosin β4: a multi-functional regenerative peptide. Basic properties and clinical applications.
Expert Opin Biol Ther · 2012
PMID 22074294PubMedThymosin beta 4 regulation of actin in sepsis.
Expert Opin Biol Ther · 2018
PMID 29508629PubMedbeta-Thymosins.
Ann N Y Acad Sci · 2007
PMID 17468232PubMed
Titles and journals pulled from PubMed and cached for 7 days. Links open in a new tab.