Reference-grade research compound
PNC-27
PNC-27, a synthetic 32-residue chimeric peptide fusing a p53(12-26) HDM-2-binding domain to an antennapedia cell-penetrating sequence
Sequence schematic — no PDB structure deposited
- Scientific name
- PNC-27, a synthetic 32-residue chimeric peptide fusing a p53(12-26) HDM-2-binding domain to an antennapedia cell-penetrating sequence
- Sequence
- PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG
- Length
- 32-mer
- Molecular formula
- C189H304N62O45S1
- Molecular weight
- 4106.90 g/mol
- Form
- lyophilized
- Vial size
- 10 mg
- Storage
- Store lyophilized powder at −20 °C, desiccated and protected from light. Stable for 24 months.
- Batch HPLC purity
- 99.3%
Description
Synthetic 32-residue chimeric peptide combining an HDM-2-binding domain derived from the p53 tumor-suppressor region (residues 12-26) with an antennapedia-derived cell-penetrating leader sequence. Used in vitro as a reference compound in HDM-2 binding and cancer-cell membrane permeabilization assay model systems. Supplied as a lyophilized acetate salt.
Storage and stability
Store lyophilized powder at −20 °C, desiccated and protected from light. Stable for 24 months.
Peer-reviewed references
PNC-27, a Chimeric p53-Penetratin Peptide Binds to HDM-2 in a p53 Peptide-like Structure, Induces Selective Membrane-Pore Formation and Leads to Cancer Cell Lysis.
Biomedicines · 2022
PMID 35625682PubMedThe anti-cancer peptide, PNC-27, induces tumor cell lysis as the intact peptide.
Cancer Chemother Pharmacol · 2010
PMID 20182728PubMedAnti-Cancer Peptide PNC-27 Kills Cancer Cells by Unique Interactions with Plasma Membrane-Bound hdm-2 and with Mitochondrial Membranes Causing Mitochondrial Disruption.
Ann Clin Lab Sci · 2024
PMID 38802154PubMed
Titles and journals pulled from PubMed and cached for 7 days. Links open in a new tab.