Reference-grade research compound
LL37
LL-37; the C-terminal 37-residue antimicrobial peptide of human cathelicidin hCAP18
PDB 2K6O
- Scientific name
- LL-37; the C-terminal 37-residue antimicrobial peptide of human cathelicidin hCAP18
- Sequence
- [LL-37, 37 aa]
- Length
- 37-mer
- Molecular formula
- C205H340N60O53
- Molecular weight
- 4493.33 g/mol
- Form
- lyophilized
- Vial size
- 5 mg
- Storage
- Store lyophilized powder at −20 °C, desiccated and protected from light. Stable for 24 months.
- Batch HPLC purity
- 99.8%
Description
Cationic amphipathic 37-residue peptide corresponding to the mature antimicrobial domain of human cathelicidin hCAP18. Used in vitro as a reference compound in membrane-permeabilization assays and antimicrobial and immunomodulatory cell-culture model systems. Supplied as a lyophilized acetate salt.
Storage and stability
Store lyophilized powder at −20 °C, desiccated and protected from light. Stable for 24 months.
Peer-reviewed references
Roles and Mechanisms of Human Cathelicidin LL-37 in Cancer.
Cell Physiol Biochem · 2018
PMID 29843147PubMedLL-37: Structures, Antimicrobial Activity, and Influence on Amyloid-Related Diseases.
Biomolecules · 2024
PMID 38540740PubMedHuman Cathelicidin Peptide LL-37 Induces Cell Death in Autophagy-Dysfunctional Endothelial Cells.
J Immunol · 2022
PMID 35387840PubMed
Titles and journals pulled from PubMed and cached for 7 days. Links open in a new tab.