Reference-grade research compound
IGF-1 LR3
Long R3 insulin-like growth factor-1; 83-residue recombinant analog of human IGF-1 with an Arg3 substitution and a 13-residue N-terminal extension
Loading 3D structure…
PDB 1GZR
- Scientific name
- Long R3 insulin-like growth factor-1; 83-residue recombinant analog of human IGF-1 with an Arg3 substitution and a 13-residue N-terminal extension
- Sequence
- MFPAMPLSSLFVNGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
- Length
- 83-mer
- Molecular formula
- C400H625N111O115S9
- Molecular weight
- 9117.60 g/mol
- Form
- lyophilized
- Available sizes
- 0.1 mg, 1 mg
- Storage
- Store lyophilized powder at −20 °C, desiccated and protected from light. Stable for 24 months.
- Batch HPLC purity
- 99.3%
Description
Recombinant 83-residue analog of human insulin-like growth factor-1 carrying an Arg3 substitution and a 13-residue N-terminal extension that lowers affinity for IGF-binding proteins. Used in vitro as a reference compound in IGF-1 receptor signaling and cell-proliferation assays in cultured cell-line model systems. Supplied as a lyophilized acetate salt.
Storage and stability
Store lyophilized powder at −20 °C, desiccated and protected from light. Stable for 24 months.
Peer-reviewed references
Titles and journals pulled from PubMed and cached for 7 days. Links open in a new tab.